Skip to content

Reference information only. Therapept does not sell peptides and does not provide medical advice.Research-use notice

Therapept
Weight & MetabolismAmylin analogue

Pramlintide

Pramlintide is studied as a amylin analogue in biochemical and physiological models.

DiscontinuedPreclinical Models Only (Animal / Lab)Also known as: Symlin, AC-137Skip to Human Evidence ↓
Other Research Areas

Pramlintide Biological Classification

Research Record

Investigated within physiological and chemical models.

At a glancePlain English, then the evidence
Not graded

What kind of compound

Peptide

Amylin analogue.

Human testing on file

0human records

0 animal · 0 total indexed. No plain-English evidence summary on file.

Regulatory position

Formerly approved — discontinued

Studied for

Amylin analogues

Reviewed 15 September 2026

Known safety concerns in this file

  • No sourced human safety summary is recorded for this compound.

Commonly compared with

No comparison set is recorded for this compound yet.

Open side-by-side comparison →
1

What is Pramlintide?

Pramlintide is classified as a amylin analogue. A 37-residue analogue of human amylin, approved in 2005 as SYMLIN. Drugs@FDA lists every SYMLIN product under its application as discontinued. Cagrilintide, also in this library, is a later investigational amylin analogue.

2

Why are people interested in it?

Researchers and clinicians study Pramlintide primarily to understand its biological interactions, receptor binding affinity, and potential role within its biochemical class.

Primary Research Categories

  • Amylin analogues
  • Discontinued drug substances
3

How does it work in the body?

Pramlintide interacts with specific cellular receptors and metabolic pathways corresponding to its structural classification as a amylin analogue.

In Everyday Language: In laboratory settings, Pramlintide interacts with specific cellular targets to modulate biological signaling pathways associated with amylin analogue biology.
Cellular & Receptor Signaling: Pramlintide interacts with specific cellular receptors and metabolic pathways corresponding to its structural classification as a amylin analogue.

Biological Pathway Overview

Pramlintide Receptor & Target Interactions

This compound is evaluated in scientific research for its interactions with target cellular receptors and signaling cascades. Consult the evidence section below for specific peer-reviewed papers.

Target Pathway

Engages specific cellular signaling cascades characteristic of its structural family.

Endocrine/Paracrine Activity

Investigated for its regulatory effects on local tissue synthesis and cellular signaling.

4

What has actually been demonstrated in humans?

Preclinical Models Only (Animal / Lab)

Evidence for Pramlintide is currently derived primarily from laboratory or preclinical models. Consult the published evidence file for specific indexed studies.

Pharmaceutical Reality vs. Unregulated Research Chemicals

Pramlintide is not an FDA-approved medication. Always verify chemical identity and testing documentation before interpreting research literature.

5

What is still uncertain or unknown?

Controlled human clinical trials evaluating Pramlintide for therapeutic efficacy, safety, and pharmacokinetics are limited or absent in peer-reviewed Western registries.

Regulatory Position: Pramlintide is an investigational or unapproved compound. It is not approved by the FDA as a commercial pharmaceutical.

Companion Resources & Guides

Evidence Landscape→

Primary research publications and study designs indexed for Pramlintide.

Research at a Glance

Open the full evidence file (0 records)

No evidence records in this file yet.

What Has Actually Been Studied

    What is Still Unknown

    What we know

      Editorial reading of the records below, labelled as Therapept analysis. How records are built

      What remains uncertain

        Preparation and Handling

        Lyophilized peptides ship as freeze-dried powders; whatever happens next involves diluents, concentrations and storage conditions that are compound- and product-specific.

        Preparation Resource HubWhat “lyophilized” meansConcentration calculator

        United States Regulatory Status

        Formerly approved — discontinued

        Application: NDA 021332 (SYMLIN) — every product listed as discontinued

        Approved Indication: Not stated here. The products are listed as discontinued and no current label was retrievable to verify indication wording.

        • SYMLIN (pramlintide acetate), NDA 021332, originally approved 16 March 2005.
        • Drugs@FDA lists every SYMLIN product under NDA 021332 as discontinued. No current label was returned by the openFDA label endpoint at review.
        • Not named on the WADA 2026 Prohibited List.
        Technical Chemical SpecificationsClick to view CAS, sequence, and molecular formulas
        Molecular weight
        3949 g/mol
        Sequence length
        86 chars
        CAS number
        151126-32-8
        PubChem CID
        70691388
        Compound class
        Amylin analogue
        Sequence
        KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2, with a disulfide bond between Cys2 and Cys7
        Molecular formula
        C171H267N51O53S2
        Molecular weight
        3949 g/mol
        CAS number
        151126-32-8
        PubChem CID
        70691388

        Sources

        1. PubChem CID 70691388
        2. Drugs@FDA — NDA 021332 (SYMLIN)
        3. WADA 2026 Prohibited ListEffective 1 January 2026.

        Last reviewed 15 September 2026 · Compiled by Therapept Editorial · How these records are built