Amylin analogue
Pramlintide
A 37-residue analogue of human amylin, approved in 2005 as SYMLIN. Drugs@FDA lists every SYMLIN product under its application as discontinued. Cagrilintide, also in this library, is a later investigational amylin analogue.
Why people are interested in Pramlintide
A 37-residue analogue of human amylin, approved in 2005 as SYMLIN. Drugs@FDA lists every SYMLIN product under its application as discontinued. Cagrilintide, also in this library, is a later investigational amylin analogue.
- Amylin analogues— a research-category classification, not a claimed use
- Discontinued drug substances— a research-category classification, not a claimed use
Where the interest comes from differs by compound: published research, an approved use, clinical discussion, community discussion and vendor claims are different things. This page keeps them apart — the sections below say which kind of source supports each statement.
Quick facts
- Molecular weight
- 3949 g/mol
- Sequence length
- 86 chars
- CAS number
- 151126-32-8
- PubChem CID
- 70691388
0 evidence records indexed · 0 clinical trials · last reviewed 15 September 2026
Research at a glance
No evidence records in this file yet.
What has actually been studied
What is still unknown
What we know
Editorial reading of the records below, labelled as Therapept analysis. How records are built
What remains uncertain
Preparation and handling
Lyophilized peptides ship as powders; whatever happens next involves diluents, concentrations and storage conditions that are compound- and product-specific. Therapept’s preparation guides explain the vocabulary and the arithmetic; the product’s own documentation states its requirements.
United States regulatory status
Formerly approved — discontinued
NDA 021332 (SYMLIN) — every product listed as discontinued
Not stated here. The products are listed as discontinued and no current label was retrievable to verify indication wording.
- SYMLIN (pramlintide acetate), NDA 021332, originally approved 16 March 2005.
- Drugs@FDA lists every SYMLIN product under NDA 021332 as discontinued. No current label was returned by the openFDA label endpoint at review.
- Not named on the WADA 2026 Prohibited List.
Regulatory status describes how a substance is classified. It is not a safety assessment, and it says nothing about the quality of any particular material.
Technical identity
- Compound class
- Amylin analogue
- Sequence
- KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2, with a disulfide bond between Cys2 and Cys7
- Molecular formula
- C171H267N51O53S2
- Molecular weight
- 3949 g/mol
- CAS number
- 151126-32-8
- PubChem CID
- 70691388
- Research categories
- Amylin analogues, Discontinued drug substances
Sources
- PubChem CID 70691388
- Drugs@FDA — NDA 021332 (SYMLIN)
- WADA 2026 Prohibited ListEffective 1 January 2026.
Last reviewed 15 September 2026 · Compiled by Therapept Editorial · How these records are built