Skip to content

Reference information only. Therapept does not sell peptides and does not provide medical advice.Research-use notice

Therapept

GHRH analogue — human GHRH (1-29) amide

Sermorelin

A GHRH analogue that formerly held an approved United States drug product. GEREF was approved in 1997 and is recorded in Drugs@FDA as discontinued; no current FDA label is retrievable.

Also listed as: Geref, GRF(1-29)NH2, Sermorelin acetate

Chemical identity

Compound class
GHRH analogue — human GHRH (1-29) amide
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Molecular formula
C149H246N44O42S
Molecular weight
3357.9 g/mol
CAS number
86168-78-7
PubChem CID
16132413
Research categories
GHRH analogues, Discontinued drug substances

United States regulatory status

Formerly approved — discontinued

NDA 020443 (GEREF) — marketing status: discontinued

Not stated here. The product is discontinued and no current FDA label was retrievable to verify the approved indication wording.

  • GEREF (sermorelin acetate for injection), NDA 020443, originally approved 26 September 1997.
  • Drugs@FDA records the marketing status as discontinued. There is no currently marketed approved sermorelin product in the United States.
  • Not listed on FDA's Category 2 or withdrawn-nomination compounding tables.

Anti-doping status

Named at S2.2.4 among GHRH analogues. Prohibited at all times; non-Specified.

Regulatory status describes how a substance is classified. It is not a safety assessment, and it says nothing about the quality of any particular material.

Evidence overview

3 records in this file

  • REVIEW1
  • REGULATORY2

Research areas. Anti-doping; Discontinued approved product; United States approval.

Publication span. 1997–2026.

Open the evidence file

What we know

  • GEREF (NDA 020443) was approved in 1997 and is recorded in Drugs@FDA as discontinued.
  • A 1999 review maps the labelled-era paediatric GH-deficiency literature. No current FDA label is retrievable.
  • WADA lists GHRH analogues, including this one.

Editorial reading of the records below, labelled as Therapept analysis. How records are built

What remains uncertain

  • Exact approved-indication wording, because no current label is retrievable — already flagged on the identity record.
  • What, if anything, currently marketed research-use material has in common with discontinued GEREF.

Sources

  1. PubChem CID 16132413
  2. Drugs@FDA — approved drug products
  3. WADA 2026 Prohibited ListEffective 1 January 2026.

Last reviewed 3 September 2026 · Compiled by Therapept Editorial · How these records are built