GHRH analogue — human GHRH (1-29) amide
Sermorelin
A GHRH analogue that formerly held an approved United States drug product. GEREF was approved in 1997 and is recorded in Drugs@FDA as discontinued; no current FDA label is retrievable.
Also listed as: Geref, GRF(1-29)NH2, Sermorelin acetate
Chemical identity
- Compound class
- GHRH analogue — human GHRH (1-29) amide
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Molecular formula
- C149H246N44O42S
- Molecular weight
- 3357.9 g/mol
- CAS number
- 86168-78-7
- PubChem CID
- 16132413
- Research categories
- GHRH analogues, Discontinued drug substances
United States regulatory status
Formerly approved — discontinued
NDA 020443 (GEREF) — marketing status: discontinued
Not stated here. The product is discontinued and no current FDA label was retrievable to verify the approved indication wording.
- GEREF (sermorelin acetate for injection), NDA 020443, originally approved 26 September 1997.
- Drugs@FDA records the marketing status as discontinued. There is no currently marketed approved sermorelin product in the United States.
- Not listed on FDA's Category 2 or withdrawn-nomination compounding tables.
Anti-doping status
Named at S2.2.4 among GHRH analogues. Prohibited at all times; non-Specified.
Regulatory status describes how a substance is classified. It is not a safety assessment, and it says nothing about the quality of any particular material.
Evidence overview
3 records in this file
- REVIEW1
- REGULATORY2
Research areas. Anti-doping; Discontinued approved product; United States approval.
Publication span. 1997–2026.
Open the evidence fileWhat we know
- GEREF (NDA 020443) was approved in 1997 and is recorded in Drugs@FDA as discontinued.
- A 1999 review maps the labelled-era paediatric GH-deficiency literature. No current FDA label is retrievable.
- WADA lists GHRH analogues, including this one.
Editorial reading of the records below, labelled as Therapept analysis. How records are built
What remains uncertain
- Exact approved-indication wording, because no current label is retrievable — already flagged on the identity record.
- What, if anything, currently marketed research-use material has in common with discontinued GEREF.
Sources
- PubChem CID 16132413
- Drugs@FDA — approved drug products
- WADA 2026 Prohibited ListEffective 1 January 2026.
Last reviewed 3 September 2026 · Compiled by Therapept Editorial · How these records are built
