Skip to content

Reference information only. Therapept does not sell peptides and does not provide medical advice.Research-use notice

Therapept
Weight & MetabolismInvestigational long-acting acylated amylin analogue

Cagrilintide

Cagrilintide is studied as a investigational long-acting acylated amylin analogue in biochemical and physiological models.

InvestigationalPreclinical Models Only (Animal / Lab)Skip to Human Evidence ↓
Other Research Areas

Cagrilintide Biological Classification

Research Record

Investigated within physiological and chemical models.

At a glancePlain English, then the evidence
Not graded

What kind of compound

Peptide

Investigational long-acting acylated amylin analogue.

Human testing on file

0human records

0 animal · 0 total indexed. No plain-English evidence summary on file.

Regulatory position

Investigational

Studied for

Amylin analogues

Reviewed 15 September 2026

Known safety concerns in this file

  • No sourced human safety summary is recorded for this compound.

Commonly compared with

No comparison set is recorded for this compound yet.

Open side-by-side comparison →
1

What is Cagrilintide?

Cagrilintide is classified as a investigational long-acting acylated amylin analogue. An investigational acylated amylin analogue with no FDA-approved product. ClinicalTrials.gov lists Novo Nordisk studies of cagrilintide alone and co-administered with semaglutide, including completed Phase 3 trials.

2

Why are people interested in it?

Researchers and clinicians study Cagrilintide primarily to understand its biological interactions, receptor binding affinity, and potential role within its biochemical class.

Primary Research Categories

  • Amylin analogues
  • Investigational drug substances
3

How does it work in the body?

Cagrilintide interacts with specific cellular receptors and metabolic pathways corresponding to its structural classification as a investigational long-acting acylated amylin analogue.

In Everyday Language: In laboratory settings, Cagrilintide interacts with specific cellular targets to modulate biological signaling pathways associated with investigational long-acting acylated amylin analogue biology.
Cellular & Receptor Signaling: Cagrilintide interacts with specific cellular receptors and metabolic pathways corresponding to its structural classification as a investigational long-acting acylated amylin analogue.

Biological Pathway Overview

Cagrilintide Receptor & Target Interactions

This compound is evaluated in scientific research for its interactions with target cellular receptors and signaling cascades. Consult the evidence section below for specific peer-reviewed papers.

Target Pathway

Engages specific cellular signaling cascades characteristic of its structural family.

Endocrine/Paracrine Activity

Investigated for its regulatory effects on local tissue synthesis and cellular signaling.

4

What has actually been demonstrated in humans?

Preclinical Models Only (Animal / Lab)

Evidence for Cagrilintide is currently derived primarily from laboratory or preclinical models. Consult the published evidence file for specific indexed studies.

Pharmaceutical Reality vs. Unregulated Research Chemicals

Cagrilintide is not an FDA-approved medication. Always verify chemical identity and testing documentation before interpreting research literature.

5

What is still uncertain or unknown?

Controlled human clinical trials evaluating Cagrilintide for therapeutic efficacy, safety, and pharmacokinetics are limited or absent in peer-reviewed Western registries.

Regulatory Position: Cagrilintide is an investigational or unapproved compound. It is not approved by the FDA as a commercial pharmaceutical.

Companion Resources & Guides

Evidence Landscape→

Primary research publications and study designs indexed for Cagrilintide.

Research at a Glance

Open the full evidence file (0 records)

No evidence records in this file yet.

What Has Actually Been Studied

    What is Still Unknown

    What we know

      Editorial reading of the records below, labelled as Therapept analysis. How records are built

      What remains uncertain

        Combinations and Stacks

        • Cagrilintide + Semaglutide

          An investigational amylin analogue combined with an approved GLP-1 receptor agonist in a sponsor's Phase 3 programme for weight management — the rare pairing where the combination itself is genuinely under study..

        Preparation and Handling

        Lyophilized peptides ship as freeze-dried powders; whatever happens next involves diluents, concentrations and storage conditions that are compound- and product-specific.

        Preparation Resource HubWhat “lyophilized” meansConcentration calculator

        United States Regulatory Status

        Investigational

        • No approved United States product in Drugs@FDA as of this review.
        • ClinicalTrials.gov returned 44 registered studies with cagrilintide as an intervention at review, including the Phase 3 REDEFINE 1 (NCT05567796) and REDEFINE 2 (NCT05394519) trials of cagrilintide with semaglutide.
        • Not interchangeable with pramlintide, the earlier approved amylin analogue.
        • Not named on the WADA 2026 Prohibited List.
        Technical Chemical SpecificationsClick to view CAS, sequence, and molecular formulas
        Molecular weight
        4409 g/mol
        Sequence length
        140 chars
        CAS number
        1415456-99-3
        PubChem CID
        171397054
        Compound class
        Investigational long-acting acylated amylin analogue
        Sequence
        C20 diacid–γGlu–KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2, with a disulfide between the two cysteines, as given by PubChem's systematic name
        Molecular formula
        C194H312N54O59S2
        Molecular weight
        4409 g/mol
        CAS number
        1415456-99-3
        PubChem CID
        171397054