Skip to content

Reference information only. Therapept does not sell peptides and does not provide medical advice.Research-use notice

Therapept

Investigational long-acting acylated amylin analogue

Cagrilintide

An investigational acylated amylin analogue with no FDA-approved product. ClinicalTrials.gov lists Novo Nordisk studies of cagrilintide alone and co-administered with semaglutide, including completed Phase 3 trials.

Investigational

Why people are interested in Cagrilintide

An investigational acylated amylin analogue with no FDA-approved product. ClinicalTrials.gov lists Novo Nordisk studies of cagrilintide alone and co-administered with semaglutide, including completed Phase 3 trials.

  • Amylin analogues— a research-category classification, not a claimed use
  • Investigational drug substances— a research-category classification, not a claimed use

Where the interest comes from differs by compound: published research, an approved use, clinical discussion, community discussion and vendor claims are different things. This page keeps them apart — the sections below say which kind of source supports each statement.

Quick facts

Molecular weight
4409 g/mol
Sequence length
140 chars
CAS number
1415456-99-3
PubChem CID
171397054

0 evidence records indexed · 0 clinical trials · last reviewed 15 September 2026

Research at a glance

No evidence records in this file yet.

Open the full evidence file

What has actually been studied

    What is still unknown

    What we know

      Editorial reading of the records below, labelled as Therapept analysis. How records are built

      What remains uncertain

        Combinations and stacks

        • Cagrilintide + Semaglutide

          An investigational amylin analogue combined with an approved GLP-1 receptor agonist in a sponsor's Phase 3 programme for weight management — the rare pairing where the combination itself is genuinely under study..

        Stack pages state plainly whether the combination itself has been studied — which, for community stacks, it has not.

        Preparation and handling

        Lyophilized peptides ship as powders; whatever happens next involves diluents, concentrations and storage conditions that are compound- and product-specific. Therapept’s preparation guides explain the vocabulary and the arithmetic; the product’s own documentation states its requirements.

        What “lyophilized” meansReconstitution basicsStorage, by source kindConcentration calculator

        United States regulatory status

        Investigational

        • No approved United States product in Drugs@FDA as of this review.
        • ClinicalTrials.gov returned 44 registered studies with cagrilintide as an intervention at review, including the Phase 3 REDEFINE 1 (NCT05567796) and REDEFINE 2 (NCT05394519) trials of cagrilintide with semaglutide.
        • Not interchangeable with pramlintide, the earlier approved amylin analogue.
        • Not named on the WADA 2026 Prohibited List.

        Regulatory status describes how a substance is classified. It is not a safety assessment, and it says nothing about the quality of any particular material.

        Technical identity

        Compound class
        Investigational long-acting acylated amylin analogue
        Sequence
        C20 diacid–γGlu–KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2, with a disulfide between the two cysteines, as given by PubChem's systematic name
        Molecular formula
        C194H312N54O59S2
        Molecular weight
        4409 g/mol
        CAS number
        1415456-99-3
        PubChem CID
        171397054
        Research categories
        Amylin analogues, Investigational drug substances