Skip to content

Reference information only. Therapept does not sell peptides and does not provide medical advice.Research-use notice

Therapept
Inflammation & Immune Research37-residue peptide derived from human cathelicidin

Cathelicidin LL-37

Cathelicidin LL-37 is studied as a 37-residue peptide derived from human cathelicidin; antimicrobial peptide in biochemical and physiological models.

UnapprovedPreclinical Models Only (Animal / Lab)Also known as: LL-37, CAP18, RopocamptideSkip to Human Evidence ↓
Other Research Areas

Cathelicidin LL-37 Biological Classification

Research Record

Investigated within physiological and chemical models.

At a glancePlain English, then the evidence
Not graded

What kind of compound

Peptide

37-residue peptide derived from human cathelicidin.

Human testing on file

0human records

0 animal · 0 total indexed. No plain-English evidence summary on file.

Regulatory position

No FDA-approved product

Studied for

Antimicrobial peptides

Reviewed 15 September 2026

Known safety concerns in this file

  • No sourced human safety summary is recorded for this compound.

Commonly compared with

No comparison set is recorded for this compound yet.

Open side-by-side comparison →
1

What is Cathelicidin LL-37?

Cathelicidin LL-37 is classified as a 37-residue peptide derived from human cathelicidin; antimicrobial peptide. A 37-residue peptide derived from the human cathelicidin protein. No FDA-approved drug product exists, and FDA lists it among bulk substances whose compounding nominations were withdrawn.

2

Why are people interested in it?

Researchers and clinicians study Cathelicidin LL-37 primarily to understand its biological interactions, receptor binding affinity, and potential role within its biochemical class.

Primary Research Categories

  • Antimicrobial peptides
  • Preclinical research compounds
3

How does it work in the body?

Cathelicidin LL-37 interacts with specific cellular receptors and metabolic pathways corresponding to its structural classification as a 37-residue peptide derived from human cathelicidin; antimicrobial peptide.

In Everyday Language: In laboratory settings, Cathelicidin LL-37 interacts with specific cellular targets to modulate biological signaling pathways associated with 37-residue peptide derived from human cathelicidin; antimicrobial peptide biology.
Cellular & Receptor Signaling: Cathelicidin LL-37 interacts with specific cellular receptors and metabolic pathways corresponding to its structural classification as a 37-residue peptide derived from human cathelicidin; antimicrobial peptide.

Biological Pathway Overview

Cathelicidin LL-37 Receptor & Target Interactions

This compound is evaluated in scientific research for its interactions with target cellular receptors and signaling cascades. Consult the evidence section below for specific peer-reviewed papers.

Target Pathway

Engages specific cellular signaling cascades characteristic of its structural family.

Endocrine/Paracrine Activity

Investigated for its regulatory effects on local tissue synthesis and cellular signaling.

4

What has actually been demonstrated in humans?

Preclinical Models Only (Animal / Lab)

Evidence for Cathelicidin LL-37 is currently derived primarily from laboratory or preclinical models. Consult the published evidence file for specific indexed studies.

Pharmaceutical Reality vs. Unregulated Research Chemicals

Cathelicidin LL-37 is not an FDA-approved medication. Always verify chemical identity and testing documentation before interpreting research literature.

5

What is still uncertain or unknown?

Controlled human clinical trials evaluating Cathelicidin LL-37 for therapeutic efficacy, safety, and pharmacokinetics are limited or absent in peer-reviewed Western registries.

Regulatory Position: Cathelicidin LL-37 is an investigational or unapproved compound. It is not approved by the FDA as a commercial pharmaceutical.

Companion Resources & Guides

Evidence Landscape→

Primary research publications and study designs indexed for Cathelicidin LL-37.

Research at a Glance

Open the full evidence file (0 records)

No evidence records in this file yet.

What Has Actually Been Studied

    What is Still Unknown

    What we know

      Editorial reading of the records below, labelled as Therapept analysis. How records are built

      What remains uncertain

        Preparation and Handling

        Lyophilized peptides ship as freeze-dried powders; whatever happens next involves diluents, concentrations and storage conditions that are compound- and product-specific.

        Preparation Resource HubWhat “lyophilized” meansConcentration calculator

        United States Regulatory Status

        No FDA-approved product

        • No approved drug product exists in Drugs@FDA.
        • Listed as “Cathelicidin LL-37” on FDA's table of bulk substances nominated for compounding and withdrawn. FDA's published concerns include immunogenicity risk for certain routes, peptide-related impurities and API characterisation, and insufficient safety information.
        • FDA's entry also notes nonclinical findings suggesting detrimental effects on male reproduction and that the substance can be protumorigenic in some tissues.
        • Not named on the WADA 2026 Prohibited List.
        Technical Chemical SpecificationsClick to view CAS, sequence, and molecular formulas
        Molecular weight
        4493 g/mol
        Sequence length
        37 chars
        CAS number
        154947-66-7
        PubChem CID
        16198951
        Compound class
        37-residue peptide derived from human cathelicidin; antimicrobial peptide
        Sequence
        [LL-37, 37 aa]
        Molecular formula
        C205H340N60O53
        Molecular weight
        4493 g/mol
        CAS number
        154947-66-7
        PubChem CID
        16198951