Skip to content

Reference information only. Therapept does not sell peptides and does not provide medical advice.Research-use notice

Therapept
Weight & MetabolismGLP-1 receptor agonist (synthetic exendin-4)

Exenatide

Exenatide is studied as a glp-1 receptor agonist (synthetic exendin-4) in biochemical and physiological models.

ApprovedPreclinical Models Only (Animal / Lab)Also known as: Byetta, Bydureon, Exendin-4Skip to Human Evidence ↓
Other Research Areas

Exenatide Biological Classification

Research Record

Investigated within physiological and chemical models.

At a glancePlain English, then the evidence
Not graded

What kind of compound

Peptide

GLP-1 receptor agonist (synthetic exendin-4).

Human testing on file

0human records

0 animal · 0 total indexed. No plain-English evidence summary on file.

Regulatory position

FDA-approved drug substance

Studied for

Incretin analogues

Reviewed 15 September 2026

Known safety concerns in this file

  • No sourced human safety summary is recorded for this compound.

Commonly compared with

No comparison set is recorded for this compound yet.

Open side-by-side comparison →
1

What is Exenatide?

Exenatide is classified as a glp-1 receptor agonist (synthetic exendin-4). A synthetic 39-residue peptide amide that the FDA label describes as originally identified in the Gila monster, Heloderma suspectum. The branded BYETTA and BYDUREON products are listed as discontinued in Drugs@FDA; a generic exenatide application is listed as a prescription product.

2

Why are people interested in it?

Researchers and clinicians study Exenatide primarily to understand its biological interactions, receptor binding affinity, and potential role within its biochemical class.

Primary Research Categories

  • Incretin analogues
  • Approved drug substances
3

How does it work in the body?

Exenatide interacts with specific cellular receptors and metabolic pathways corresponding to its structural classification as a glp-1 receptor agonist (synthetic exendin-4).

In Everyday Language: In laboratory settings, Exenatide interacts with specific cellular targets to modulate biological signaling pathways associated with glp-1 receptor agonist (synthetic exendin-4) biology.
Cellular & Receptor Signaling: Exenatide interacts with specific cellular receptors and metabolic pathways corresponding to its structural classification as a glp-1 receptor agonist (synthetic exendin-4).

Biological Pathway Overview

Exenatide Receptor & Target Interactions

This compound is evaluated in scientific research for its interactions with target cellular receptors and signaling cascades. Consult the evidence section below for specific peer-reviewed papers.

Target Pathway

Engages specific cellular signaling cascades characteristic of its structural family.

Endocrine/Paracrine Activity

Investigated for its regulatory effects on local tissue synthesis and cellular signaling.

4

What has actually been demonstrated in humans?

Preclinical Models Only (Animal / Lab)

Evidence for Exenatide is currently derived primarily from laboratory or preclinical models. Consult the published evidence file for specific indexed studies.

Pharmaceutical Reality vs. Unregulated Research Chemicals

Exenatide is not an FDA-approved medication. Always verify chemical identity and testing documentation before interpreting research literature.

5

What is still uncertain or unknown?

Controlled human clinical trials evaluating Exenatide for therapeutic efficacy, safety, and pharmacokinetics are limited or absent in peer-reviewed Western registries.

Regulatory Position: Exenatide is an investigational or unapproved compound. It is not approved by the FDA as a commercial pharmaceutical.

Companion Resources & Guides

Evidence Landscape→

Primary research publications and study designs indexed for Exenatide.

Research at a Glance

Open the full evidence file (0 records)

No evidence records in this file yet.

What Has Actually Been Studied

    What is Still Unknown

    What we know

      Editorial reading of the records below, labelled as Therapept analysis. How records are built

      What remains uncertain

        Preparation and Handling

        Lyophilized peptides ship as freeze-dried powders; whatever happens next involves diluents, concentrations and storage conditions that are compound- and product-specific.

        Preparation Resource HubWhat “lyophilized” meansConcentration calculator

        United States Regulatory Status

        FDA-approved drug substance

        Application: NDA 021773 (BYETTA), NDA 022200 (BYDUREON), NDA 209210 (BYDUREON BCISE) — listed as discontinued; ANDA 206697 (exenatide) — prescription

        Approved Indication: Approved in the United States as an adjunct to diet and exercise to improve glycaemic control in adults with type 2 diabetes mellitus (BYETTA labelling).

        • BYETTA, NDA 021773, originally approved 28 April 2005.
        • Drugs@FDA lists the BYETTA, BYDUREON and BYDUREON BCISE products as discontinued as of this review.
        • ANDA 206697 (exenatide, synthetic), dated 19 November 2024, is listed as a prescription product.
        • Not named on the WADA 2026 Prohibited List.
        Technical Chemical SpecificationsClick to view CAS, sequence, and molecular formulas
        Molecular weight
        4186.6 Da (FDA label); 4187 g/mol (PubChem)
        Sequence length
        43 chars
        CAS number
        141758-74-9
        PubChem CID
        45588096
        Compound class
        GLP-1 receptor agonist (synthetic exendin-4)
        Sequence
        HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
        Molecular formula
        C184H282N50O60S
        Molecular weight
        4186.6 Da (FDA label); 4187 g/mol (PubChem)
        CAS number
        141758-74-9
        PubChem CID
        45588096