Skip to content

Reference information only. Therapept does not sell peptides and does not provide medical advice.Research-use notice

Therapept

GLP-1 receptor agonist (synthetic exendin-4)

Exenatide

A synthetic 39-residue peptide amide that the FDA label describes as originally identified in the Gila monster, Heloderma suspectum. The branded BYETTA and BYDUREON products are listed as discontinued in Drugs@FDA; a generic exenatide application is listed as a prescription product.

ApprovedAlso listed as: Byetta, Bydureon, Exendin-4

Why people are interested in Exenatide

A synthetic 39-residue peptide amide that the FDA label describes as originally identified in the Gila monster, Heloderma suspectum. The branded BYETTA and BYDUREON products are listed as discontinued in Drugs@FDA; a generic exenatide application is listed as a prescription product.

  • Incretin analogues— a research-category classification, not a claimed use
  • Approved drug substances— a research-category classification, not a claimed use

Where the interest comes from differs by compound: published research, an approved use, clinical discussion, community discussion and vendor claims are different things. This page keeps them apart — the sections below say which kind of source supports each statement.

Quick facts

Molecular weight
4186.6 Da (FDA label); 4187 g/mol (PubChem)
Sequence length
43 chars
CAS number
141758-74-9
PubChem CID
45588096

0 evidence records indexed · 0 clinical trials · last reviewed 15 September 2026

Research at a glance

No evidence records in this file yet.

Open the full evidence file

What has actually been studied

    What is still unknown

    What we know

      Editorial reading of the records below, labelled as Therapept analysis. How records are built

      What remains uncertain

        Preparation and handling

        Lyophilized peptides ship as powders; whatever happens next involves diluents, concentrations and storage conditions that are compound- and product-specific. Therapept’s preparation guides explain the vocabulary and the arithmetic; the product’s own documentation states its requirements.

        What “lyophilized” meansReconstitution basicsStorage, by source kindConcentration calculator

        United States regulatory status

        FDA-approved drug substance

        NDA 021773 (BYETTA), NDA 022200 (BYDUREON), NDA 209210 (BYDUREON BCISE) — listed as discontinued; ANDA 206697 (exenatide) — prescription

        Approved in the United States as an adjunct to diet and exercise to improve glycaemic control in adults with type 2 diabetes mellitus (BYETTA labelling).

        • BYETTA, NDA 021773, originally approved 28 April 2005.
        • Drugs@FDA lists the BYETTA, BYDUREON and BYDUREON BCISE products as discontinued as of this review.
        • ANDA 206697 (exenatide, synthetic), dated 19 November 2024, is listed as a prescription product.
        • Not named on the WADA 2026 Prohibited List.

        Regulatory status describes how a substance is classified. It is not a safety assessment, and it says nothing about the quality of any particular material.

        Technical identity

        Compound class
        GLP-1 receptor agonist (synthetic exendin-4)
        Sequence
        HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
        Molecular formula
        C184H282N50O60S
        Molecular weight
        4186.6 Da (FDA label); 4187 g/mol (PubChem)
        CAS number
        141758-74-9
        PubChem CID
        45588096
        Research categories
        Incretin analogues, Approved drug substances